Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 17 - Jul 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Renin, His TagProduct Specification Species Human Accession P00797 Amino Acid Sequence
Product Specification
| Species | Human |
| Accession | P00797 |
| Amino Acid Sequence | LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 44.0 kDa (reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles. |
Background
Renin, also known as angiotensinogen enzyme, is a proteolytic enzyme released by paraspheroidal granulosa cells and is part of the renin-angiotensin system. Renin acts on plasma angiotensingen to produce inactive angiotensin I, which is hydrolyzed to active angiotensin II under the action of angiotensin converting enzyme. Angiotensin II can cause arteriolar vasoconstriction and promote the synthesis and secretion of aldosterone in adrenal cortex. Plasma Renin activity test can be used to diagnose primary aldosteronism and hypertension.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 8 reviews
Sort
Product Reviews
★★★★★ 5
I use it for myself not my pet
I sewed a fluffy velcro pouch to put this in, and then I wrapped the pouch around a microwavable heat gel pack in order to get the sensation of both heat and heartbeat while hugging a large stuffed animal. It works great. It's not too loud if you position it right. It helps me to fall asleep and not feel lonely or touch starved. The battery lasts a long time and I don't have to recharge it very often. I only wish that the speed of the heartbeat was adjustable so that I could slow it down a little more so that my own heartbeat might try to match it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2024
★★★★★ 1
Easily Exposed Lithium Ion Battery
I am returning this item for my money back. Apparently, they think they can charge $16 for a piece of plastic and not even put a screw on the back to hold the panel closed. My dog is smart and a little rough when anxious. I wanted a rechargeable heart (to avoid buying batteries) to help with this anxiety but cannot risk the Velcro coming undone and him biting the heart by mistake. The panel slides off very easily. There's a reason that lithium ion batteries aren't usually easily accessible. I'm not risking my dog discovering a battery and wire in the heart. Even with appropriate supervision, accidents happen. I don't even understand why I would need to access the battery when it's rechargeable. I don't recommend purchasing this product for that reason alone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 17, 2022
★★★★★ 4
Works great!
It works great, don't have to buy batteries.
07/-8/25
Marilyn A.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2025
★★★★★ 5
bottle baby kittens preferred this heartbeat to having warm snuggle safe heat disk
Ok... when I got this I thought.. "are you kidding me?" they are going to like this.
Joke was on me. They love it. It is rhythmic and it is strong enough that it pulsates the area so all of them can feel it. They consistently would lay on top of the heart rather than in the area of their "crib" where the heat was.. and this was when they were still only a few days old! It works.
So this is what you want to know.
It beats continuously for about 4-5 days without needing a recharge.
Recharge is fast and only takes a couple hours
The button is slightly "inside" the unit so when it is placed upside down there is no way that it can accidentally be turned off. Which is great. If the button were on the upside in the pet space then a foot or body part of the little animal could turn it off inadvertantly. Design to put the button slightly inset is extremely important design feature - makes this excellent. When I turn it on I know it will be going as long as the battery still has charge. .
I don't think it is waterproof so I put it under the pee pad that I had under the blanket bedding and it was still easily heard AND felt. If not using a pee pad I would definitely put it in a small ziplock bag to protect from any leaked urine or liquids to keep it safe.
When the kittens were done eating they would gravitate towards the heart beat... (with their eyes open or when they were still closed after birth it was the same response). This little gadget was a total lifesaver as it really calmed the kittens in ways I would not be able to.
These pictures are of the trio that LOVED this.... Meet Zen (tabby M with white feet), Sugar (tuxedo F with white feet) and Rocket (ginger - M). All cisgender. they were about 3 days old when I got them to foster.. photos from arrival until about 3 weeks of age. Photo with q-tip is to give relative size on arrival. They will be up for adoption in Tustin CA in another 2-3 weeks time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2023
★★★★★ 5
Fantastic!
The heart that came with Snuggle Puppy was a pain to replace the battery. This is the only rechargeable heart I could find searching online. I was a little concerned reading it’s a “frequently returned item.” But happy to say, we will not be returning this! It shipped charged and the heart is still beating non-stop days later! It’s sturdy and fits in the snuggle puppy perfectly. We have a tiny 17 yr old Chihuahua who never chewed anything up so it’s completely safe for her to enjoy. It helps with her anxiety. You can hear the beat in the video—it’s nice and loud and has a bit of a vibration. Our pup has been sleeping next to it every night. Very happy with this purchase. From reading reviews, I trust if we have an issue with it, their customer service will help. For now, it works! I really like that it has time options—can set it for 2 hrs of heart beating or non-stop.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2024